TA330512 WDSUB1 antibody

Rabbit Polyclonal Anti-WDSUB1 Antibody

See related secondary antibodies

Search for all "WDSUB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human WDSUB1

Product Description for WDSUB1

Rabbit anti Human WDSUB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDSUB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SAM and U-box domain-containing protein 1, WD repeat, WDSAM1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9V3
Immunogen:
The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS.
GeneID:
151525
Application WB
Background WDSUB1 contains 1 SAM (sterile alpha motif) domain, 1 U-box domain and 7 WD repeats. The function of WDSUB1 remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WDSUB1 (5 products)

Catalog No. Species Pres. Purity   Source  

WDSUB1 (transcript variant 3)

WDSUB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

WDSUB1

WDSUB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WDSUB1

WDSUB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WDSUB1

WDSUB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

WDSUB1

WDSUB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for WDSUB1 (1 products)

Catalog No. Species Pres. Purity   Source  

WDSUB1 293T Cell Transient Overexpression Lysate(Denatured)

WDSUB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn