TA330555 CTBP1 antibody

Rabbit Polyclonal Anti-CTBP1 Antibody

See related secondary antibodies

Search for all "CTBP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat CTBP1

TA330555

More Views

  • TA330555
  • TA330555

Product Description for CTBP1

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat CTBP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CTBP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-terminal-binding protein 1, CTBP
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13363
Immunogen:
The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL.
GeneID:
1487
Application WB
IHC
Background The phosphoprotein C-termil binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptiol repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CTBP1 (7 products)

Catalog No. Species Pres. Purity   Source  

CTBP1 (transcript variant 1)

CTBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CTBP1 (transcript variant 2)

CTBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CTBP1 (1-440)

CTBP1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

CTBP1 (1-440)

CTBP1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

CTBP1

CTBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CTBP1

CTBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CTBP1

SDS-Page: CtBP1 Protein [NBP1-41161] - CtBP1, 47.5 kDa (440aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for CTBP1 (3 products)

Catalog No. Species Pres. Purity   Source  

CtBP1 Lysate

Western Blot: CtBP1 Lysate [NBL1-09563] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CTBP1
  Novus Biologicals Inc.

CtBP1 Lysate

Western Blot: CtBP1 Lysate [NBL1-09564] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CTBP1
  Novus Biologicals Inc.

CTBP1 overexpression lysate

CTBP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn