TA330579 ZNF278 antibody

Rabbit Polyclonal Anti-PATZ1 Antibody

See related secondary antibodies

Search for all "ZNF278"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF278

TA330579

More Views

  • TA330579
  • TA330579
  • TA330579

Product Description for ZNF278

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF278.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF278

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AT hook-, BTB-POZ domain zinc finger transcription factor, PATZ, PATZ1, POZ-, Protein kinase A RI subunit alpha-associated protein, RIAZ, ZBTB19, ZSG, Zinc finger and BTB domain-containing protein 19, Zinc finger protein 278, Zinc finger sarcoma gene protein, and zinc finger-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HBE1
Immunogen:
The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the N terminal of human PATZ1. Synthetic peptide located within the following region: KNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGP.
GeneID:
23598
Application WB
Background PATZ1 contains an A-T hook D binding motif which usually binds to other D binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF278 (6 products)

Catalog No. Species Pres. Purity   Source  

ZNF278 (full length, N-term HIS tag, transcript variant 4)

ZNF278 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF278 (full length, N-term HIS tag, transcript variant 1)

ZNF278 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF278

ZNF278 Human Purified
  Abnova Taiwan Corp.

ZNF278

ZNF278 Human Purified
  Abnova Taiwan Corp.

ZNF278

ZNF278 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF278

ZNF278 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF278 (3 products)

Catalog No. Species Pres. Purity   Source  

PATZ1 overexpression lysate

PATZ1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PATZ Lysate

Western Blot: PATZ Lysate [NBL1-14126] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PATZ1.
  Novus Biologicals Inc.

ZNF278 293T Cell Transient Overexpression Lysate(Denatured)

ZNF278 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn