TA330583 NR5A2 / CPF antibody

Rabbit Polyclonal Anti-NR5A2 Antibody

See related secondary antibodies

Search for all "NR5A2 / CPF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish NR5A2 / CPF

Product Description for NR5A2 / CPF

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish NR5A2 / CPF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NR5A2 / CPF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AFP Receptor, Alpha-1-Fetoprotein transcription factor, B1-binding factor, B1F, CYP7A promoter-binding factor, FTF, Hepatocytic transcription factor, Liver receptor homolog 1, Nuclear receptor subfamily 5 group A member 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00482
Immunogen:
The immunogen for anti-NR5A2 antibody: synthetic peptide directed towards the middle region of human NR5A2. Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS.
GeneID:
2494
Application WB
Background NR5A2 binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combition with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NR5A2 / CPF (4 products)

Catalog No. Species Pres. Purity   Source  

NR5A2 / CPF

NR5A2 / CPF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NR5A2 / CPF

NR5A2 / CPF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NR5A2 / CPF

NR5A2 / CPF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NR5A2 / CPF

NR5A2 / CPF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn