TA330626 LASS2 antibody

Rabbit Polyclonal Anti-LASS2 Antibody

See related secondary antibodies

Search for all "LASS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LASS2

TA330626

More Views

  • TA330626

Product Description for LASS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LASS2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for LASS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LAG1 longevity assurance homolog 2, LASS2, SP260, TMSG1, Tumor metastasis-suppressor gene 1 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96G23
Immunogen:
The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: EKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRR.
GeneID:
29956
Application WB
IHC
Background LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Altertively spliced transcript variants encoding the same protein have been described.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LASS2 (5 products)

Catalog No. Species Pres. Purity   Source  

LASS2 (transcript variant 2)

LASS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LASS2 (transcript variant 1)

LASS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LASS2

LASS2 Human
  Abnova Taiwan Corp.

LASS2

LASS2 Human in vitro transl.
  Abnova Taiwan Corp.

LASS2

LASS2 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LASS2 (5 products)

Catalog No. Species Pres. Purity   Source  

CERS2 overexpression lysate

CERS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CERS2 overexpression lysate

CERS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CERS2 overexpression lysate

CERS2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

LASS2 Lysate(Denatured)

LASS2 Lysate(Denatured)
  Abnova Taiwan Corp.

LASS2 Lysate

Western Blot: LASS2 Lysate [NBL1-12441] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LASS2
  Novus Biologicals Inc.
  • LinkedIn