Home » HNF4 alpha / TCF14

TA330637 HNF4 alpha / TCF14 antibody

Rabbit Polyclonal Anti-HNF4A Antibody

0.1 ml / €360.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HNF4 alpha / TCF14

More Views

Product Description for HNF4 alpha / TCF14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HNF4 alpha / TCF14.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HNF4 alpha / TCF14

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	HNF4, HNF4A, Hepatocyte nuclear factor 4-alpha, NR2A1, Nuclear receptor subfamily 2 group A member 1, Transcription factor 14, Transcription factor HNF-4
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications	P, WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P41235 Immunogen: The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV. GeneID: 3172
Application	WB IHC
Background	The protein encoded by this gene is a nuclear transcription factor which binds D as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal domint non-insulin-dependent diabetes mellitus type I. Altertive splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012].
Format	Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HNF4 alpha / TCF14 (8 products)

Catalog No.	Species	Pres.	Purity	Source
TP317863	HNF4 alpha / TCF14 (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP311443	HNF4 alpha / TCF14 (transcript variant 5)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP316588	HNF4 alpha / TCF14 (transcript variant 6)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP317924	HNF4 alpha / TCF14 (transcript variant 3)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00003172-P01-10	HNF4 alpha / TCF14
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003172-P01-25	HNF4 alpha / TCF14
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00003172-Q01-10	HNF4 alpha / TCF14
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003172-Q01-25	HNF4 alpha / TCF14
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Positive controls for HNF4 alpha / TCF14 (6 products)

Catalog No.	Species
H00003172-T01	HNF4A 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-11632	HNF4 alpha Lysate

		Novus Biologicals Inc.
LY405861	HNF4A overexpression lysate
		0.1 mg / €495.00
		OriGene Technologies, Inc.
LY422283	HNF4A overexpression lysate
		0.1 mg / €495.00
		OriGene Technologies, Inc.
LY422284	HNF4A overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
LY425507	HNF4A overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for HNF4 alpha / TCF14 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH

Click here to see all secondary antibodies for HNF4 alpha / TCF14

Antibodies (see all»)

Kits (see all»)

Antigens

Lysates (see all»)

Tissue Slides (see all»)

Other life-science products