TA330644 HOXD12 / HOX4H antibody

Rabbit Polyclonal Anti-HOXD12 Antibody

See related secondary antibodies

Search for all "HOXD12 / HOX4H"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat HOXD12 / HOX4H

TA330644

More Views

  • TA330644

Product Description for HOXD12 / HOX4H

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat HOXD12 / HOX4H.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HOXD12 / HOX4H

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-D12, Hox-4H
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35452
Immunogen:
The immunogen for anti-HOXD12 antibody: synthetic peptide directed towards the N terminal of human HOXD12. Synthetic peptide located within the following region: MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP.
GeneID:
3238
Application WB
IHC
Background HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for HOXD12 / HOX4H (1 products)

Catalog No. Species Pres. Purity   Source  

HOXD12 overexpression lysate

HOXD12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn