TA330645 Heat shock factor 4 / HSF4 antibody

Rabbit Polyclonal Anti-HSF4 Antibody

See related secondary antibodies

Search for all "Heat shock factor 4 / HSF4"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rabbit Heat shock factor 4 / HSF4

Product Description for Heat shock factor 4 / HSF4

Rabbit anti Human, Rabbit Heat shock factor 4 / HSF4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Heat shock factor 4 / HSF4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSF-4, HSTF4, Heat shock transcription factor 4
Presentation Purified
Reactivity Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULV5
Immunogen:
The immunogen for anti-HSF4 antibody: synthetic peptide directed towards the middle region of human HSF4. Synthetic peptide located within the following region: VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPT.
GeneID:
3299
Application WB
Background Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-termil hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of D binding activity. Two altertively spliced transcripts encoding distinct isoforms and possessing different transcriptiol activity have been described.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Heat shock factor 4 / HSF4 (3 products)

Catalog No. Species Pres. Purity   Source  

Heat shock factor 4 / HSF4 (full length, N-term HIS tag, transcript variant 2)

Heat shock factor 4 / HSF4 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Heat shock factor 4 / HSF4

Heat shock factor 4 / HSF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Heat shock factor 4 / HSF4

Heat shock factor 4 / HSF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Heat shock factor 4 / HSF4 (1 products)

Catalog No. Species Pres. Purity   Source  

HSF4 293T Cell Transient Overexpression Lysate(Denatured)

HSF4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn