TA330684 NDUFAF7 antibody

Rabbit Polyclonal Anti-NDUFAF7 Antibody

See related secondary antibodies

Search for all "NDUFAF7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NDUFAF7

Product Description for NDUFAF7

Rabbit anti Human NDUFAF7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NDUFAF7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C2orf56, NADH dehydrogenase [ubiquinone] complex I, Protein midA homolog, assembly factor 7, mitochondrial
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L592
Immunogen:
The immunogen for Anti-C2orf56 antibody is: synthetic peptide directed towards the C-terminal region of Human C2orf56. Synthetic peptide located within the following region: QQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQSKPFASVV.
GeneID:
55471
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDUFAF7 (1 products)

Catalog No. Species Pres. Purity   Source  

NDUFAF7 (transcript variant 1)

NDUFAF7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for NDUFAF7 (1 products)

Catalog No. Species Pres. Purity   Source  

C2orf56 Lysate

Western Blot: midA Lysate [NBL1-08421] - 
Left-Control; Right -Over-expression Lysate for midA. Protein
  Novus Biologicals Inc.
  • LinkedIn