TA330691 FAM222B antibody

Rabbit Polyclonal Anti-FAM222B Antibody

See related secondary antibodies

Search for all "FAM222B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FAM222B

Product Description for FAM222B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FAM222B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM222B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C17orf63
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WU58
Immunogen:
The immunogen for Anti-FAM222B antibody is: synthetic peptide directed towards the C-terminal region of Human FAM222B. Synthetic peptide located within the following region: VNGMAAPLAYPNGHYFQPLWNNILPTPNSDSSGSQDLAMPFHGGQPTGAP.
GeneID:
55731
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM222B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM222B (full length, N-term HIS tag, transcript variant 2)

FAM222B Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for FAM222B (1 products)

Catalog No. Species Pres. Purity   Source  

C17orf63 Lysate

Western Blot: C17orf63 Lysate [NBL1-08241] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C17orf63 Protein
  Novus Biologicals Inc.
  • LinkedIn