TA330707 ZSWIM5 antibody

Rabbit Polyclonal Anti-ZSWIM5 Antibody

See related secondary antibodies

Search for all "ZSWIM5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZSWIM5

Product Description for ZSWIM5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZSWIM5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZSWIM5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1511, Zinc finger SWIM domain-containing protein 5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P217
Immunogen:
The immunogen for Anti-ZSWIM5 antibody is: synthetic peptide directed towards the C-terminal region of Human ZSWIM5. Synthetic peptide located within the following region: ISPRHYGEFIEFLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLL.
GeneID:
57643
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZSWIM5 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSWIM5 overexpression lysate

ZSWIM5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn