TA330736 NDNF antibody

Rabbit Polyclonal Anti-NDNF Antibody

See related secondary antibodies

Search for all "NDNF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat NDNF

Product Description for NDNF

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat NDNF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NDNF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C4orf31, Neuron-derived neurotrophic factor
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TB73
Immunogen:
The immunogen for Anti-NDNF antibody is: synthetic peptide directed towards the C-terminal region of Human NDNF. Synthetic peptide located within the following region: NEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGK.
GeneID:
79625
Application WB
Background NDNF promotes matrix assembly and cell adhesiveness. It promotes neuron migration, growth and survival as well as neurite outgrowth.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDNF (1 products)

Catalog No. Species Pres. Purity   Source  

NDNF

NDNF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
  OriGene Technologies, Inc.

Positive controls for NDNF (2 products)

Catalog No. Species Pres. Purity   Source  

C4orf31 Lysate

Western Blot: C4orf31 Lysate [NBL1-08472] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C4orf31 Protein
  Novus Biologicals Inc.

NDNF overexpression lysate

NDNF overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn