TA330781 TMEM116 antibody

Rabbit Polyclonal Anti-TMEM116 Antibody

See related secondary antibodies

Search for all "TMEM116"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat TMEM116

Product Description for TMEM116

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat TMEM116.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM116

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane protein 116
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCL8
Immunogen:
The immunogen for Anti-TMEM116 antibody is: synthetic peptide directed towards the C-terminal region of Human TMEM116. Synthetic peptide located within the following region: QRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGL.
GeneID:
89894
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM116 (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM116

TMEM116 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMEM116

TMEM116 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TMEM116 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM116 overexpression lysate

TMEM116 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn