TA330906 Thioredoxin / TRX1 antibody

Rabbit Polyclonal Anti-TXN Antibody

See related secondary antibodies

Search for all "Thioredoxin / TRX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Thioredoxin / TRX1

Product Description for Thioredoxin / TRX1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Thioredoxin / TRX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Thioredoxin / TRX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADF, ATL-derived factor, SASP, Surface-associated sulphydryl protein, TRDX, TRX, TXN
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10599
Immunogen:
The immunogen for Anti-TXN antibody is: synthetic peptide directed towards the C-terminal region of Human TXN. Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT.
GeneID:
7295
Application WB
Background TXN participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. It plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. It nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. It induces the FOS/JUN AP-1 D-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptiol activity.ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55)
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Thioredoxin / TRX1 (21 products)

Catalog No. Species Pres. Purity   Source  

Thioredoxin / TRX1

Thioredoxin / TRX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Thioredoxin / TRX1 (1-105)

Thioredoxin / TRX1 Human Purified ≥ 95 by SDS PAGE E. coli
0.5 mg / €600.00
  OriGene Technologies GmbH

Thioredoxin / TRX1 (1-105)

Thioredoxin / TRX1 Human Purified ≥ 95 by SDS PAGE E. coli
0.1 mg / €250.00
  OriGene Technologies GmbH

Thioredoxin / TRX1 (1-105, His-tag)

Recombinant human TXN, 1-105 aa, His-tagged: 15% SDS-PAGE (3 ug) Human Purified > 95 % by SDS – PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

Thioredoxin / TRX1 (1-105, His-tag)

Recombinant human TXN, 1-105 aa, His-tagged: 15% SDS-PAGE (3 ug) Human Purified > 95 % by SDS – PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Human Purified > 95 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Human Purified > 95 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Human Purified > 95 % Greater than 90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Yeast Purified > 95 % Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Anion-exchange FPLC.
(c) Analysis by reducing and non-reducing SDS-PAGE Silver Stained.
E. coli
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Yeast Purified > 95 % Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Anion-exchange FPLC.
(c) Analysis by reducing and non-reducing SDS-PAGE Silver Stained.
E. coli
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Yeast Purified > 95 % Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Anion-exchange FPLC.
(c) Analysis by reducing and non-reducing SDS-PAGE Silver Stained.
E. coli
  OriGene Technologies GmbH

Thioredoxin / TRX1

Thioredoxin / TRX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Thioredoxin / TRX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Thioredoxin / TRX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Thioredoxin / TRX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Thioredoxin / TRX1 Human
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Thioredoxin / TRX1 Human
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Thioredoxin / TRX1 Human
  Abnova Taiwan Corp.

Thioredoxin / TRX1

Western Blot: Thioredoxin Protein [NBC1-18541] - 15% SDS-PAGE (3ug) Protein
  Novus Biologicals Inc.

Thioredoxin / TRX1

SDS-Page: Thioredoxin Protein [NBP1-44476] - Thioredoxin 1,12.9 kDa (119aa), confirmed by MALDI-TOF with a purity of 85% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Thioredoxin / TRX1

SDS-Page: Thioredoxin Protein [NBP1-44488] - TXN, 13.9 kDa (125aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Positive controls for Thioredoxin / TRX1 (1 products)

Catalog No. Species Pres. Purity   Source  

TXN 293T Cell Transient Overexpression Lysate(Denatured)

TXN 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn