TA330909 CRABP2 antibody

Rabbit Polyclonal Anti-CRABP2 Antibody

See related secondary antibodies

Search for all "CRABP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CRABP2

Product Description for CRABP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CRABP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CRABP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRABP-II, Cellular retinoic acid-binding protein 2, Cellular retinoic acid-binding protein II
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P29373
Immunogen:
The immunogen for Anti-CRABP2 antibody is: synthetic peptide directed towards the middle region of Human CRABP2. Synthetic peptide located within the following region: PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVV.
GeneID:
1382
Application WB
Background A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptiolly regulated by a newly synthesized regulatory protein.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CRABP2 (6 products)

Catalog No. Species Pres. Purity   Source  

CRABP2

CRABP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CRABP2 (1-138)

CRABP2 Human Purified > 95 % > 95% by SDS PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

CRABP2 (1-138)

CRABP2 Human Purified > 95 % > 95% by SDS PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

CRABP2

CRABP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CRABP2

CRABP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CRABP2

SDS-Page: CRABP2 Protein [NBC1-18490] - CRABP2, 15.6 kDa (138 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for CRABP2 (3 products)

Catalog No. Species Pres. Purity   Source  

CRABP2 293T Cell Transient Overexpression Lysate(Denatured)

CRABP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CRABP2 Lysate

Western Blot: CRABP2 Lysate [NBL1-09458] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CRABP2.
  Novus Biologicals Inc.

CRABP2 overexpression lysate

CRABP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn