TA330947 ELMOD2 antibody

Rabbit polyclonal Anti-ELMOD2 Antibody

See related secondary antibodies

Search for all "ELMOD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ELMOD2

Product Description for ELMOD2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ELMOD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ELMOD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ELMO domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZ81
Immunogen:
The immunogen for anti-ELMOD2 antibody: synthetic peptide directed towards the N terminal of human ELMOD2. Synthetic peptide located within the following region: FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN.
GeneID:
255520
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ELMOD2 (3 products)

Catalog No. Species Pres. Purity   Source  

ELMOD2

ELMOD2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ELMOD2

ELMOD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ELMOD2

ELMOD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ELMOD2 (2 products)

Catalog No. Species Pres. Purity   Source  

ELMOD2 Lysate

Western Blot: ELMOD2 Lysate [NBL1-10241] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ELMOD2
  Novus Biologicals Inc.

ELMOD2 overexpression lysate

ELMOD2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn