TA330964 C6orf146 antibody

Rabbit polyclonal Anti-C6orf146 Antibody

See related secondary antibodies

Search for all "C6orf146"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C6orf146

Product Description for C6orf146

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C6orf146.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C6orf146

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C6orf146
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IXS0
Immunogen:
The immunogen for anti-C6orf146 antibody: synthetic peptide directed towards the middle region of human C6orf146. Synthetic peptide located within the following region: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP.
GeneID:
222826
Application WB
Background The specific function of C6orf146 is not yet known.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C6orf146 (1 products)

Catalog No. Species Pres. Purity   Source  

FAM217A overexpression lysate

FAM217A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn