TA330967 TIGD3 antibody

Rabbit polyclonal Anti-TIGD3 Antibody

See related secondary antibodies

Search for all "TIGD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TIGD3

Product Description for TIGD3

Rabbit anti Human TIGD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TIGD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Tigger transposable element-derived protein 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6B0B8
Immunogen:
The immunogen for anti-TIGD3 antibody: synthetic peptide directed towards the middle region of human TIGD3. Synthetic peptide located within the following region: FVDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRW.
GeneID:
220359
Application WB
Background TIGD3 belongs to the tigger subfamily of the pogo superfamily of D-mediated transposons in humans. These proteins are related to D transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known. The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of D-mediated transposons in humans. These proteins are related to D transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn