Home » Maleylacetoacetate isomerase / GSTZ1

TA330970 Maleylacetoacetate isomerase / GSTZ1 antibody

Rabbit polyclonal Anti-GSTZ1 Antibody

Search for all "Maleylacetoacetate isomerase / GSTZ1"

0.1 ml / €300.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat Maleylacetoacetate isomerase / GSTZ1

Product Description for Maleylacetoacetate isomerase / GSTZ1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat Maleylacetoacetate isomerase / GSTZ1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Maleylacetoacetate isomerase / GSTZ1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	GSTZ-1, GSTZ1-1, Glutathione S-transferase zeta 1, MAAI
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: O43708 Immunogen: The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1. Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF. GeneID: 2954
Application	WB
Background	GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosiemia.This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctiol enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosiemia. Several transcript variants of this gene encode multiple protein isoforms.
Format	Purification: Protein A purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Maleylacetoacetate isomerase / GSTZ1 (12 products)

Catalog No.	Species	Pres.	Purity	Source
TP314568	Maleylacetoacetate isomerase / GSTZ1 (transcript variant 3)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP720541	Maleylacetoacetate isomerase / GSTZ1 (transcript variant 3)
	Human		> 95 % Preparation: . Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.	E. coli
					OriGene Technologies, Inc.
AR09390PU-L	Maleylacetoacetate isomerase / GSTZ1 (1-216, His-tag)
	Human	Purified	> 95 % by SDS - PAGE	E. coli	0.5 mg / €720.00
					OriGene Technologies GmbH
AR09390PU-N	Maleylacetoacetate isomerase / GSTZ1 (1-216, His-tag)
	Human	Purified	> 95 % by SDS - PAGE	E. coli	0.1 mg / €290.00
					OriGene Technologies GmbH
H00002954-P01-02	Maleylacetoacetate isomerase / GSTZ1
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00002954-P01-10	Maleylacetoacetate isomerase / GSTZ1
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00002954-P01-25	Maleylacetoacetate isomerase / GSTZ1
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00002954-Q01-10	Maleylacetoacetate isomerase / GSTZ1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00002954-Q01-25	Maleylacetoacetate isomerase / GSTZ1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
10-288-22033F	Maleylacetoacetate isomerase / GSTZ1
	Human	Purified	95 %	E. coli
					GenWay Biotech Inc.
10-288-22033F-50	Maleylacetoacetate isomerase / GSTZ1
	Human	Purified	95 %	E. coli
					GenWay Biotech Inc.
NBP1-40410	Maleylacetoacetate isomerase / GSTZ1
		Liquid
					Novus Biologicals Inc.

Positive controls for Maleylacetoacetate isomerase / GSTZ1 (3 products)

Catalog No.	Species
H00002954-T01	GSTZ1 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-11379	GSTZ1 Lysate

		Novus Biologicals Inc.
LY419867	GSTZ1 overexpression lysate

		OriGene Technologies, Inc.

Recommended Secondary Antibodies for Maleylacetoacetate isomerase / GSTZ1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH