TA331013 RABGGTA antibody

Rabbit polyclonal Anti-RABGGTA Antibody

See related secondary antibodies

Search for all "RABGGTA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RABGGTA

TA331013

More Views

  • TA331013

Product Description for RABGGTA

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RABGGTA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RABGGTA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Geranylgeranyl transferase type-2 subunit alpha, Rab GGTase alpha, Rab geranylgeranyltransferase subunit alpha
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92696
Immunogen:
The immunogen for anti-RABGGTA antibody: synthetic peptide directed towards the N terminal of human RABGGTA. Synthetic peptide located within the following region: ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL.
GeneID:
5875
Application WB
Background RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-termil, such as RAB1A, RAB3A and RAB5A respectively.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RABGGTA (3 products)

Catalog No. Species Pres. Purity   Source  

RABGGTA (transcript variant 2)

RABGGTA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RABGGTA

RABGGTA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABGGTA

RABGGTA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RABGGTA (4 products)

Catalog No. Species Pres. Purity   Source  

RABGGTA 293T Cell Transient Overexpression Lysate(Denatured)

RABGGTA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RABGGTA overexpression lysate

RABGGTA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Tuberin Lysate

Western Blot: RABGGTA Lysate [NBL1-15096] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RABGGTA
  Novus Biologicals Inc.

Tuberin Lysate

Western Blot: RABGGTA Lysate [NBL1-15097] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RABGGTA
  Novus Biologicals Inc.
  • LinkedIn