TA331043 TEX2 antibody

Rabbit polyclonal Anti-TEX2 Antibody

See related secondary antibodies

Search for all "TEX2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TEX2

TA331043

More Views

  • TA331043

Product Description for TEX2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TEX2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TEX2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1738, Testis-expressed sequence 2 protein
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWB9
Immunogen:
The immunogen for anti-TEX2 antibody: synthetic peptide directed towards the N terminal of human TEX2. Synthetic peptide located within the following region: KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL.
GeneID:
55852
Application WB
Background TEX2 is a multi-pass membrane protein. The exact function of TEX2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TEX2 (1 products)

Catalog No. Species Pres. Purity   Source  

TEX2 293T Cell Transient Overexpression Lysate(Denatured)

TEX2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn