TA331051 SULF2 antibody

Rabbit polyclonal Anti-SULF2 Antibody

See related secondary antibodies

Search for all "SULF2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SULF2

TA331051

More Views

  • TA331051

Product Description for SULF2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SULF2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SULF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Extracellular sulfatase Sulf-2, KIAA1247
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWU5
Immunogen:
The immunogen for anti-SULF2 antibody: synthetic peptide directed towards the C terminal of human SULF2. Synthetic peptide located within the following region: DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW.
GeneID:
55959
Application WB
IHC
Background Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell sigling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for sigling molecules.Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell sigling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for sigling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SULF2 (4 products)

Catalog No. Species Pres. Purity   Source  

SULF2

SULF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SULF2

SULF2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SULF2

SULF2 Human Purified
  Abnova Taiwan Corp.

SULF2

SULF2 Human Purified
  Abnova Taiwan Corp.

Positive controls for SULF2 (4 products)

Catalog No. Species Pres. Purity   Source  

SULF2 overexpression lysate

SULF2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SULF2 overexpression lysate

SULF2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SULF2 overexpression lysate

SULF2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

Sulfatase 2 Lysate

Western Blot: Sulfatase 2 Lysate [NBL1-16599] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SULF2
  Novus Biologicals Inc.
  • LinkedIn