TA331054 PCDHAC2 antibody

Rabbit polyclonal Anti-PCDHAC2 Antibody

See related secondary antibodies

Search for all "PCDHAC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PCDHAC2

Product Description for PCDHAC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PCDHAC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCDHAC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PCDH-alpha-C2, Protocadherin alpha-C2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5I4
Immunogen:
The immunogen for anti-PCDHAC2 antibody: synthetic peptide directed towards the N terminal of human PCDHAC2. Synthetic peptide located within the following region: SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR.
GeneID:
56134
Application WB
Background PCDHAC2 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintence of specific neurol connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-termil exons, or variable exons, are followed by downstream C-termil exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-termil exons each encode six cadherin ectodomains while the C-termil exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Altertive splicing has been observed and additiol variants have been suggested but their full-length ture has yet to be determined.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCDHAC2 (4 products)

Catalog No. Species Pres. Purity   Source  

PCDHAC2

PCDHAC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCDHAC2

PCDHAC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCDHAC2

PCDHAC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCDHAC2

PCDHAC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PCDHAC2 (3 products)

Catalog No. Species Pres. Purity   Source  

PCDHAC2 293T Cell Transient Overexpression Lysate(Denatured)

PCDHAC2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCDHAC2 Lysate

Western Blot: PCDHAC2 Lysate [NBL1-14154] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PCDHAC2
  Novus Biologicals Inc.

PCDHAC2 overexpression lysate

PCDHAC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn