TA331061 PCDHGB1 antibody

Rabbit polyclonal Anti-PCDHGB1 Antibody

See related secondary antibodies

Search for all "PCDHGB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PCDHGB1

Product Description for PCDHGB1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PCDHGB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCDHGB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protocadherin gamma-B1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5G3
Immunogen:
The immunogen for anti-PCDHGB1 antibody: synthetic peptide directed towards the N terminal of human PCDHGB1. Synthetic peptide located within the following region: SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD.
GeneID:
56104
Application WB
Background PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintence of specific neurol connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Altertive splicing has been described for the gamma cluster genes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCDHGB1 (4 products)

Catalog No. Species Pres. Purity   Source  

PCDHGB1

PCDHGB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCDHGB1

PCDHGB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCDHGB1

PCDHGB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCDHGB1

PCDHGB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PCDHGB1 (2 products)

Catalog No. Species Pres. Purity   Source  

PCDHGB1 293T Cell Transient Overexpression Lysate(Denatured)

PCDHGB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCDHGB1 overexpression lysate

PCDHGB1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn