TA331077 FAM105A antibody

Rabbit polyclonal Anti-FAM105A Antibody

See related secondary antibodies

Search for all "FAM105A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat FAM105A

Product Description for FAM105A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat FAM105A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM105A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUU6
Immunogen:
The immunogen for anti-FAM105A antibody: synthetic peptide directed towards the middle region of human FAM105A. Synthetic peptide located within the following region: QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS.
GeneID:
54491
Application WB
Background FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM105A (2 products)

Catalog No. Species Pres. Purity   Source  

FAM105A

FAM105A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FAM105A

FAM105A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FAM105A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM105A overexpression lysate

FAM105A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn