TA331096 HLA-DQA2 antibody

Rabbit polyclonal Anti-HLA-DQA2 Antibody

See related secondary antibodies

Search for all "HLA-DQA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Goat, Human, Mouse, Rabbit, Rat, Sheep HLA-DQA2

Product Description for HLA-DQA2

Rabbit anti Bovine, Goat, Human, Mouse, Rabbit, Rat, Sheep HLA-DQA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HLA-DQA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DX alpha chain, HLA class II histocompatibility antigen DQ alpha 2 chain, HLA class II histocompatibility antigen DQ(6) alpha chain, HLA-DQA1, HLA-DXA, MHC class II DQA2
Presentation Purified
Reactivity Bov, Gt, Hu, Ms, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P01906
Immunogen:
The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS.
GeneID:
3118
Application WB
Background This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognized by CD4 T-cells.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for HLA-DQA2 (1 products)

Catalog No. Species Pres. Purity   Source  

HLA overexpression lysate

HLA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn