TA331110 SMAD6 antibody

Rabbit Polyclonal Anti-Smad6 Antibody

See related secondary antibodies

Search for all "SMAD6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SMAD6

Product Description for SMAD6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SMAD6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMAD6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MAD homolog 6, MADH6, Mothers against DPP homolog 6, Mothers against decapentaplegic homolog 6, SMAD 6, SMAD family member 6, SMAD-6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O35182
Immunogen:
The immunogen for Anti-Smad6 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Smad6. Synthetic peptide located within the following region: PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL.
GeneID:
17130
Application WB
Background Smad6 binds to regulatory elements in target promoter regions. It may block the BMP-SMAD1 sigling pathway by competing with SMAD4 for receptor-activated SMAD1-binding. It acts as a mediator of TGF-beta and BMP antiflammatory activity. It suppresses IL1R-TLR sigling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of proinflammatory genes.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn