TA331113 MARS antibody

Rabbit Polyclonal Anti-MARS Antibody

See related secondary antibodies

Search for all "MARS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MARS

Product Description for MARS

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MARS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MARS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms METRS, MTRNS, Methionyl-tRNA synthetase, cytoplasmic, methionine-tRNA synthetase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56192
Immunogen:
The immunogen for anti-MARS antibody: synthetic peptide directed towards the middle region of human MARS. Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ.
GeneID:
4141
Application WB
Background Aminoacyl-tR synthetases are a class of enzymes that charge tRs with their cogte amino acids. MARS belongs to the class I family of tR synthetases.Aminoacyl-tR synthetases are a class of enzymes that charge tRs with their cogte amino acids. The protein encoded by this gene belongs to the class I family of tR synthetases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MARS (6 products)

Catalog No. Species Pres. Purity   Source  

MARS

MARS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

MARS

MARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MARS

MARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MARS

MARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MARS

MARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MARS

MARS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MARS (3 products)

Catalog No. Species Pres. Purity   Source  

MARS 293T Cell Transient Overexpression Lysate(Denatured)

MARS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MARS overexpression lysate

MARS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Methionyl tRNA synthetase Lysate

Western Blot: Methionyl tRNA synthetase Lysate [NBL1-12901] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MARS
  Novus Biologicals Inc.
  • LinkedIn