TA331124 NKX6-1 antibody

Rabbit Polyclonal Anti-NKX6

See related secondary antibodies

Search for all "NKX6-1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NKX6-1

Product Description for NKX6-1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NKX6-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NKX6-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Nkx-6.1, NKX6A
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78426
Immunogen:
The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1. Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS.
GeneID:
4825
Application WB
Background NKX6-1 is the transcription factor which binds to specific A/T-rich D sequences in the promoter regions of a number of genes. NKX6-1 is involved in transcriptiol regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3, NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. NKX6-1 belongs to the class II proteins of neurol progenitor factors, which are induced by SHH sigls.In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctiol transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-300 U66797.1 1-300 301-307 AC096766.3 119394-119400 c 308-676 U66797.1 308-676 677-849 U66798.1 7-179 850-1116 U66799.1 7-273
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for NKX6-1 (1 products)

Catalog No. Species Pres. Purity   Source  

NKX6 overexpression lysate

NKX6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn