TA331165 ACSL1 antibody

Rabbit Polyclonal Anti-ACSL1 Antibody

See related secondary antibodies

Search for all "ACSL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat ACSL1

TA331165

More Views

  • TA331165
  • TA331165

Product Description for ACSL1

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat ACSL1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACSL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acyl-CoA synthetase 1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P33121
Immunogen:
The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1
AA Sequence:
ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY
GeneID:
2180
Application Western blotting (0.2 - 1.0 µg/ml)
Background ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
General Readings Soupene,E. (er) BMC Mol. Biol. 7, 21 (2006)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Pig, Dog, Bovine
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ACSL1 (2 products)

Catalog No. Species Pres. Purity   Source  

ACSL1

ACSL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACSL1

ACSL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn