TA331175 PCK1 / PEPCK1 antibody

Rabbit Polyclonal Anti-PCK1 Antibody

See related secondary antibodies

Search for all "PCK1 / PEPCK1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PCK1 / PEPCK1

TA331175

More Views

  • TA331175
  • TA331175
  • TA331175
  • TA331175
  • TA331175
  • TA331175
  • TA331175

Product Description for PCK1 / PEPCK1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PCK1 / PEPCK1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PCK1 / PEPCK1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PEP carboxykinase, PEPCK-C, PEPCKC, Phosphoenolpyruvate carboxykinase cytosolic [GTP], Phosphoenolpyruvate carboxylase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35558
Immunogen:
The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS.
GeneID:
5105
Application WB
IHC
Background PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCK1 / PEPCK1 (7 products)

Catalog No. Species Pres. Purity   Source  

PCK1 / PEPCK1

PCK1 / PEPCK1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PCK1 / PEPCK1 (1-622, His-tag)

PCK1 / PEPCK1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

PCK1 / PEPCK1 (1-622, His-tag)

PCK1 / PEPCK1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

PCK1 / PEPCK1

PCK1 / PEPCK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCK1 / PEPCK1

PCK1 / PEPCK1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCK1 / PEPCK1

PCK1 / PEPCK1 Human
  Abnova Taiwan Corp.

PCK1 / PEPCK1

PCK1 / PEPCK1 Human
  Abnova Taiwan Corp.

Positive controls for PCK1 / PEPCK1 (3 products)

Catalog No. Species Pres. Purity   Source  

PCK1 293T Cell Transient Overexpression Lysate(Denatured)

PCK1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCK1 Lysate

Western Blot: PCK1 Lysate [NBL1-14179] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PCK1
  Novus Biologicals Inc.

PCK1 overexpression lysate

PCK1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn