TA331176 Aquaporin-7 / AQP7 antibody

Rabbit Polyclonal Anti-AQP7 Antibody

See related secondary antibodies

Search for all "Aquaporin-7 / AQP7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Aquaporin-7 / AQP7

Product Description for Aquaporin-7 / AQP7

Rabbit anti Human Aquaporin-7 / AQP7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Aquaporin-7 / AQP7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AQP-7, AQP7L, AQP9, AQPAP, Aquaporin adipose, Aquaporin-7-like
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14520
Immunogen:
The immunogen for anti-AQP7 antibody: synthetic peptide directed towards the C terminal of human AQP7. Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA.
GeneID:
364
Application WB
Background Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Aquaporin-7 / AQP7 (3 products)

Catalog No. Species Pres. Purity   Source  

Aquaporin-7 / AQP7

Aquaporin-7 / AQP7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Aquaporin-7 / AQP7

Aquaporin-7 / AQP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Aquaporin-7 / AQP7

Aquaporin-7 / AQP7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for Aquaporin-7 / AQP7 (2 products)

Catalog No. Species Pres. Purity   Source  

AQP7 overexpression lysate

AQP7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Aquaporin-7 Lysate(Denatured)

Aquaporin-7 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn