TA331200 CEMP1 antibody

Rabbit Polyclonal Anti-CEMP1 Antibody

See related secondary antibodies

Search for all "CEMP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CEMP1

Product Description for CEMP1

Rabbit anti Human CEMP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CEMP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CP-23, CP23, Cementoblastoma-derived protein 1, Cementum protein 1, Cementum protein 23
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PRD7
Immunogen:
The immunogen for Anti-CEMP1 antibody is: synthetic peptide directed towards the C-terminal region of Human CEMP1. Synthetic peptide located within the following region: RHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTI.
GeneID:
752014
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn