TA331206 GPR160 / GPCR150 antibody

Rabbit Polyclonal Anti-GPR160 Antibody

See related secondary antibodies

Search for all "GPR160 / GPCR150"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human GPR160 / GPCR150

Product Description for GPR160 / GPCR150

Rabbit anti Equine, Human GPR160 / GPCR150.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR160 / GPCR150

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 160, GPCR1
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJ42
Immunogen:
The immunogen for Anti-GPR160 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR160. Synthetic peptide located within the following region: FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM.
GeneID:
26996
Application WB
Background GPR160 is an orphan receptor.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GPR160 / GPCR150 (1 products)

Catalog No. Species Pres. Purity   Source  

GPR160 / GPCR150

GPR160 / GPCR150 Human
  Abnova Taiwan Corp.
  • LinkedIn