TA331208 Gasdermin-A antibody

Rabbit Polyclonal Anti-GSDMA Antibody

See related secondary antibodies

Search for all "Gasdermin-A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Gasdermin-A

Product Description for Gasdermin-A

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Gasdermin-A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Gasdermin-A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GSDM, GSDM1, GSDMA, Gasdermin-1
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96QA5
Immunogen:
The immunogen for Anti-GSDMA antibody is: synthetic peptide directed towards the C-terminal region of Human GSDMA. Synthetic peptide located within the following region: ICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVE.
GeneID:
284110
Application WB
Background GSDMA induces apoptosis.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Gasdermin-A (1 products)

Catalog No. Species Pres. Purity   Source  

Gasdermin-A

Gasdermin-A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Gasdermin-A (1 products)

Catalog No. Species Pres. Purity   Source  

GSDMA overexpression lysate

GSDMA overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn