TA331214 MYLPF antibody

Rabbit Polyclonal Anti-MYLPF Antibody

See related secondary antibodies

Search for all "MYLPF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish MYLPF

Product Description for MYLPF

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish MYLPF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYLPF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fast skeletal myosin light chain 2, MLC2B, Myosin regulatory light chain 2, skeletal muscle
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A32
Immunogen:
The immunogen for Anti-MYLPF antibody is: synthetic peptide directed towards the C-terminal region of Human MYLPF. Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE.
GeneID:
29895
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MYLPF (5 products)

Catalog No. Species Pres. Purity   Source  

MYLPF

MYLPF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MYLPF (1-169, His-tag)

MYLPF Human Purified > 85 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

MYLPF (1-169, His-tag)

MYLPF Human Purified > 85 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

MYLPF

MYLPF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MYLPF

MYLPF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MYLPF (1 products)

Catalog No. Species Pres. Purity   Source  

Fast skeletal myosin light chain 2 Lysate

Western Blot: Fast skeletal myosin light chain 2 Lysate [NBL1-13433] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYLPF
  Novus Biologicals Inc.
  • LinkedIn