TA331244 ARHGAP22 antibody

Rabbit Polyclonal Anti-ARHGAP22 Antibody

See related secondary antibodies

Search for all "ARHGAP22"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ARHGAP22

TA331244

More Views

  • TA331244
  • TA331244

Product Description for ARHGAP22

Rabbit anti Human ARHGAP22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RHOGAP2, Rho GTPase-activating protein 22, Rho-type GTPase-activating protein 22, p68RacGAP
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5H3
Immunogen:
The immunogen for Anti-ARHGAP22 antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP22. Synthetic peptide located within the following region: AGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVK.
GeneID:
58504
Application WB
Background This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kise Akt and requires the Akt-dependent 14-3-3 binding protein which binds sequentially to two serine residues. The result of these interactions is regulation of cell motility. Multiple transcript variants encoding different isoforms have been found for this gene.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARHGAP22 (2 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP22

ARHGAP22 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARHGAP22 (full length, N-term HIS tag)

ARHGAP22 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for ARHGAP22 (1 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP22 overexpression lysate

ARHGAP22 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn