TA331256 G protein alpha 13 antibody

Rabbit Polyclonal Anti-GNA13 Antibody

See related secondary antibodies

Search for all "G protein alpha 13"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish G protein alpha 13

Product Description for G protein alpha 13

Rabbit anti Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish G protein alpha 13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for G protein alpha 13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-alpha-13, GNA13, Guanine nucleotide-binding protein subunit alpha-13
Presentation Purified
Reactivity GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14344
Immunogen:
The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK.
GeneID:
10672
Application WB
Background Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane sigling systems.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for G protein alpha 13 (3 products)

Catalog No. Species Pres. Purity   Source  

G protein alpha 13

G protein alpha 13 Human in vitro transl.
  Abnova Taiwan Corp.

G protein alpha 13

G protein alpha 13 Human in vitro transl.
  Abnova Taiwan Corp.

G protein alpha 13

G protein alpha 13 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for G protein alpha 13 (1 products)

Catalog No. Species Pres. Purity   Source  

GNA13 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

GNA13 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-GNA13 antibody (H00010672-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn