TA331274 Myozenin-3 antibody

Rabbit Polyclonal Anti-MYOZ3 Antibody

See related secondary antibodies

Search for all "Myozenin-3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine Myozenin-3

Product Description for Myozenin-3

Rabbit anti Canine, Equine, Human, Porcine Myozenin-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Myozenin-3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Calsarcin-3, FATZ-related protein 3, FRP3, MYOZ3
Presentation Purified
Reactivity Can, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDC0
Immunogen:
The immunogen for Anti-MYOZ3 antibody is: synthetic peptide directed towards the C-terminal region of Human MYOZ3. Synthetic peptide located within the following region: PEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPF.
GeneID:
91977
Application WB
Background The protein encoded by this gene is specifically expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin sigling.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn