TA331280 PBOV1 antibody

Rabbit Polyclonal Anti-PBOV1 Antibody

See related secondary antibodies

Search for all "PBOV1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PBOV1

Product Description for PBOV1

Rabbit anti Human PBOV1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PBOV1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Prostate and breast cancer overexpressed gene 1 protein, UC28, UROC28
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZY1
Immunogen:
The immunogen for Anti-PBOV1 antibody is: synthetic peptide directed towards the N-terminal region of Human PBOV1. Synthetic peptide located within the following region: RHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQ.
GeneID:
59351
Application WB
Background This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn