TA331282 PGLYRP3 antibody

Rabbit Polyclonal Anti-PGLYRP3 Antibody

See related secondary antibodies

Search for all "PGLYRP3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PGLYRP3

Product Description for PGLYRP3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PGLYRP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PGLYRP3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PGLYRPIalpha, PGRP-I-alpha, PGRPIA, Peptidoglycan recognition protein 3, Peptidoglycan recognition protein intermediate alpha
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LB9
Immunogen:
The immunogen for Anti-PGLYRP3 antibody is: synthetic peptide directed towards the N-terminal region of Human PGLYRP3. Synthetic peptide located within the following region: SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQG.
GeneID:
114771
Application WB
Background This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the inte immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This protein binds to murein peptidoglycans of Gram-positive bacteria.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PGLYRP3 (1 products)

Catalog No. Species Pres. Purity   Source  

PGLYRP3

PGLYRP3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for PGLYRP3 (2 products)

Catalog No. Species Pres. Purity   Source  

PGLYRP3 overexpression lysate

PGLYRP3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PGRP1A Lysate

Western Blot: PGRP1A Lysate [NBL1-14336] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PGLYRP3
  Novus Biologicals Inc.
  • LinkedIn