TA331287 Protein phosphatase 1H / PPM1H antibody

Rabbit Polyclonal Anti-PPM1H Antibody

See related secondary antibodies

Search for all "Protein phosphatase 1H / PPM1H"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Protein phosphatase 1H / PPM1H

Product Description for Protein phosphatase 1H / PPM1H

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Protein phosphatase 1H / PPM1H.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Protein phosphatase 1H / PPM1H

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARHCL1, KIAA1157
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULR3
Immunogen:
The immunogen for Anti-PPM1H antibody is: synthetic peptide directed towards the N-terminal region of Human PPM1H. Synthetic peptide located within the following region: TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSK.
GeneID:
57460
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Protein phosphatase 1H / PPM1H (1 products)

Catalog No. Species Pres. Purity   Source  

Protein phosphatase 1H / PPM1H

Protein phosphatase 1H / PPM1H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Protein phosphatase 1H / PPM1H (1 products)

Catalog No. Species Pres. Purity   Source  

PPM1H overexpression lysate

PPM1H overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn