TA331298 Sorting nexin-33 (SNX33) antibody

Rabbit Polyclonal Anti-SNX33 Antibody

See related secondary antibodies

Search for all "Sorting nexin-33 (SNX33)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish Sorting nexin-33 (SNX33)

Product Description for Sorting nexin-33 (SNX33)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish Sorting nexin-33 (SNX33).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Sorting nexin-33 (SNX33)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SH3 and PX domain-containing protein 3, SH3PX3, SH3PXD3C, SNX30
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WV41
Immunogen:
The immunogen for Anti-SNX33 antibody is: synthetic peptide directed towards the C-terminal region of Human SNX33. Synthetic peptide located within the following region: FPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEM.
GeneID:
257364
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Sorting nexin-33 (SNX33) (5 products)

Catalog No. Species Pres. Purity   Source  

Sorting nexin-33 (SNX33)

Sorting nexin-33 (SNX33) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Sorting nexin-33 (SNX33)

Sorting nexin-33 (SNX33) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Sorting nexin-33 (SNX33)

Sorting nexin-33 (SNX33) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Sorting nexin-33 (SNX33)

Sorting nexin-33 (SNX33) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sorting nexin-33 (SNX33)

Sorting nexin-33 (SNX33) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Sorting nexin-33 (SNX33) (3 products)

Catalog No. Species Pres. Purity   Source  

SH3PX3 293T Cell Transient Overexpression Lysate(Denatured)

SH3PX3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SNX33 Lysate

Western Blot: SNX33 Lysate [NBL1-16316] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SNX33
  Novus Biologicals Inc.

SNX33 overexpression lysate

SNX33 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn