TA331306 ADPRHL2 / ARH3 antibody

Rabbit Polyclonal Anti-ADPRHL2 Antibody

See related secondary antibodies

Search for all "ADPRHL2 / ARH3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ADPRHL2 / ARH3

Product Description for ADPRHL2 / ARH3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ADPRHL2 / ARH3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ADPRHL2 / ARH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylhydrolase 3, Poly(ADP-ribose) glycohydrolase ARH3, [Protein ADP-ribosylarginine] hydrolase-like protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX46
Immunogen:
The immunogen for Anti-ADPRHL2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADPRHL2. Synthetic peptide located within the following region: SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV.
GeneID:
54936
Application WB
Background This gene encodes a member of the ADP
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ADPRHL2 / ARH3 (5 products)

Catalog No. Species Pres. Purity   Source  

ADPRHL2 / ARH3

ADPRHL2 / ARH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ADPRHL2 / ARH3 (1-363, His-tag)

ADPRHL2 / ARH3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ADPRHL2 / ARH3 (1-363, His-tag)

ADPRHL2 / ARH3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ADPRHL2 / ARH3

ADPRHL2 / ARH3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ADPRHL2 / ARH3

ADPRHL2 / ARH3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ADPRHL2 / ARH3 (2 products)

Catalog No. Species Pres. Purity   Source  

ADPRHL2 Lysate

Western Blot: ADPRHL2 Lysate [NBL1-07356] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADPRHL2 Protein
  Novus Biologicals Inc.

ADPRHL2 overexpression lysate

ADPRHL2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn