TA331317 CoA synthase antibody

Rabbit Polyclonal Anti-COASY Antibody

See related secondary antibodies

Search for all "CoA synthase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat CoA synthase

Product Description for CoA synthase

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat CoA synthase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CoA synthase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Bifunctional coenzyme A synthase, COASY, Coenzyme A synthase, NBP, POV-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13057
Immunogen:
The immunogen for Anti-COASY antibody is: synthetic peptide directed towards the C-terminal region of Human COASY. Synthetic peptide located within the following region: ETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQR.
GeneID:
80347
Application WB
Background Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. COASY is a bifunctiol enzyme that catalyzes the 2 last steps in CoA synthesis. These activities are performed by 2 separate enzymes, phosphopantetheine adenylyltransferase and dephospho-CoA kise, in prokaryotes.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CoA synthase (6 products)

Catalog No. Species Pres. Purity   Source  

CoA synthase (transcript variant 2)

CoA synthase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CoA synthase (transcript variant 1)

CoA synthase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CoA synthase

CoA synthase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CoA synthase

CoA synthase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CoA synthase

CoA synthase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CoA synthase

CoA synthase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CoA synthase (6 products)

Catalog No. Species Pres. Purity   Source  

COASY 293T Cell Transient Overexpression Lysate(Denatured)

COASY 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

COASY Lysate

Western Blot: COASY Lysate [NBL1-09340] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for COASY
  Novus Biologicals Inc.

COASY Lysate

Western Blot: COASY Lysate [NBL1-09341] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for COASY
  Novus Biologicals Inc.

COASY overexpression lysate

COASY overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

COASY overexpression lysate

COASY overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

COASY overexpression lysate

COASY overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn