TA331319 COX7A2 antibody

Rabbit Polyclonal Anti-COX7A2 Antibody

See related secondary antibodies

Search for all "COX7A2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat COX7A2

Product Description for COX7A2

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat COX7A2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for COX7A2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COX7AL, Cytochrome c oxidase subunit 7A2 mitochondrial, Cytochrome c oxidase subunit VIIa-liver/heart, Cytochrome c oxidase subunit VIIaL
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14406
Immunogen:
The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the C-terminal region of Human COX7A2. Synthetic peptide located within the following region: LFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE.
GeneID:
1347
Application WB
Background Cytochrome c oxidase, the termil component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of three catalytic subunits encoded by mitochondrial genes, and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, while the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (liver isoform) of subunit VIIa, with this polypeptide being present in both muscle and non-muscle tissues. In addition to polypeptide 2, subunit VIIa includes polypeptide 1 (muscle isoform), which is present only in muscle tissues, and a related protein, which is present in all tissues.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for COX7A2 (2 products)

Catalog No. Species Pres. Purity   Source  

COX7A2

COX7A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

COX7A2

COX7A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn