TA331326 FSD2 antibody

Rabbit Polyclonal Anti-FSD2 Antibody

See related secondary antibodies

Search for all "FSD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat FSD2

Product Description for FSD2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat FSD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FSD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fibronectin type III and SPRY domain-containing protein 2, SPRY domain-containing protein 1, SPRYD1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A1L4K1
Immunogen:
The immunogen for Anti-FSD2 antibody is: synthetic peptide directed towards the C-terminal region of Human FSD2. Synthetic peptide located within the following region: DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI.
GeneID:
123722
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FSD2 (1 products)

Catalog No. Species Pres. Purity   Source  

FSD2 overexpression lysate

FSD2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn