TA331331 IRF2BP2 antibody

Rabbit Polyclonal Anti-IRF2BP2 Antibody

See related secondary antibodies

Search for all "IRF2BP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish IRF2BP2

Product Description for IRF2BP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish IRF2BP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IRF2BP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IRF-2-binding protein 2, IRF-2BP2, Interferon regulatory factor 2-binding protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5L9
Immunogen:
The immunogen for Anti-IRF2BP2 antibody is: synthetic peptide directed towards the C-terminal region of Human IRF2BP2. Synthetic peptide located within the following region: LILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQ.
GeneID:
359948
Application WB
Background This gene encodes an interferon regulatory factor-2 (IRF2) binding protein that interacts with the C-termil transcriptiol repression domain of IRF2. Altertive splicing results in multiple transcript variants encoding distinct isoforms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for IRF2BP2 (1 products)

Catalog No. Species Pres. Purity   Source  

IRF2BP2 overexpression lysate

IRF2BP2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn