TA331335 Legumain antibody

Rabbit Polyclonal Anti-LGMN Antibody

See related secondary antibodies

Search for all "Legumain"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Legumain

Product Description for Legumain

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Legumain.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Legumain

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Asparaginyl endopeptidase, EC=3.4.22.34, LGMN, Legumain, PRSC1, Protease, cysteine 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99538
Immunogen:
The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN.
GeneID:
5641
Application WB
Background This gene encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several altertively spliced transcript variants have been described, but the biological validity of only two has been determined.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Legumain (5 products)

Catalog No. Species Pres. Purity   Source  

Legumain (transcript variant 1)

Legumain Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Legumain (transcript variant 2)

Legumain Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

Legumain

Legumain Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Legumain

Legumain Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Legumain

Legumain Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Legumain (2 products)

Catalog No. Species Pres. Purity   Source  

Legumain Lysate(Denatured)

Legumain Lysate(Denatured)
  Abnova Taiwan Corp.

Legumain Lysate

Western Blot: Legumain Lysate [NBL1-12508] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LGMN
  Novus Biologicals Inc.
  • LinkedIn