TA331337 P2RY5 / LPAR6 antibody

Rabbit Polyclonal Anti-LPAR6 Antibody

See related secondary antibodies

Search for all "P2RY5 / LPAR6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish P2RY5 / LPAR6

Product Description for P2RY5 / LPAR6

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish P2RY5 / LPAR6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for P2RY5 / LPAR6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LPA receptor 6, LPA-6, Lysophosphatidic acid receptor 6, Oleoyl-L-alpha-lysophosphatidic acid receptor, P2Y purinoceptor 5, P2Y5, Purinergic receptor 5, RB intron encoded G-protein coupled receptor
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43657
Immunogen:
The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the N-terminal region of Human LPAR6. Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK.
GeneID:
10161
Application WB
Background The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an interl intron of the retinoblastoma susceptibility gene in the reverse orientation. Altertive splicing results in multiple transcript variants.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for P2RY5 / LPAR6 (3 products)

Catalog No. Species Pres. Purity   Source  

P2RY5 / LPAR6

P2RY5 / LPAR6 Human
  Abnova Taiwan Corp.

P2RY5 / LPAR6

P2RY5 / LPAR6 Human Purified
  Abnova Taiwan Corp.

P2RY5 / LPAR6

P2RY5 / LPAR6 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn